PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083361.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 1076aa    MW: 119019 Da    PI: 7.0609
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083361.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56.2e-41157234178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCevhska ++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  XP_011083361.1 157 VCQVDNCNEDLSTAKDYHRRHKVCEVHSKAGKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 234
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-34152219IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.923155232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37156235IPR004333Transcription factor, SBP-box
PfamPF031105.4E-30158231IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.0E-5249275IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.0E-5866992IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.98E-5867963IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1076 aa     Download sequence    Send to blast
MMEEVGAQVV APTVIHQTLS GRFCDSYPMA KKRGLPFHSS TYIHQNASDN WNPKSWDWDS  60
SRFVAKPLQC DEIHAGNGTQ VLPGLPRRNE LQNNAQNPRK PDHAAEDNEN LRLKLGGGDR  120
ARSDGGSGGV NFVEPQPVSR PNKRVRSGSP GGANYPVCQV DNCNEDLSTA KDYHRRHKVC  180
EVHSKAGKAL VGKQMQRFCQ QCSRFHPLSE FDEGKRSCRR RLAGHNRRRR KTQPEDSTTR  240
LLVPGSNDNN IDIVKLLAVL TRAQGNIEDR SGKVAPLPDK DQMIQILSKI SSLPLPADLA  300
ARLKGSIPNL ISSENQNQMN GKASSPATMD LLAILSATPG APSSDAFEIQ SQPSTEGSDS  360
EKTKSLCVDQ TASLNLQRGS MMEFPTVGEK TSTSYDSPME EVDFHVQETS PSLPLQLFTP  420
SPEDYRAVKS PSYRNFLSSG SSNPLEERSP VSSPPVVHNL FPMRTSREAM KDDHLSNSES  480
EIANVKATIS NECSTSLQLF RDSTLATENG SNRSSPYRAG YMSSSGSDHS PSSLNSDARD  540
RNGRIIFKLF DKDPSHLPGS LRSQIYNWLS NSPSEMESYI RPGCLVLSLY LSMPSFVWDH  600
LEENLLNYVN GLVKDIDVDF WGNGRFLVHT DRQMASHKDG KIRLCKSWRA LSTAELISVS  660
PLAVVGGQET SLLLRGRNLT APGTKIHCTH AAEYNIKQVP VASCLDTAYE EISLDCFKVD  720
VAASSVLGRC FIEVENSFRG TSFPVIIADN TICDELRLLE PEINGTEACD GILADHIQST  780
GTPRYREEVL HFLDELGWLF QRKHNSSLFG IPEYRLTRFK FLFIFSVEHD FCAVVKTLLE  840
ILLELNLGRT GLARESLEML SEIHLLNRAV KRRSRSMVDL LIHYSIVDST DTSEKFIFLP  900
NMAGPGGVTP LHLAACTSSS DDMVDALTSD PQEVGLRSWN TALDANGLSP YAYALMRNNH  960
TYNALVARKL ADRNNCQVSV SVTDEVGQFA LEMDKDKRTI SHLNQKQKSC SRCAVVAADG  1020
YKQRFPGSHG LLQRPYIHSM LLVAAVCVCV CVFLRGHPYI GCVGPFAWEN LGYGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31148231184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1867872RAVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083361.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A075FJP10.0A0A075FJP1_SALMI; SQUAM
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14